PDB entry 1dlx

View 1dlx on RCSB PDB site
Description: the solution structure of the the c-terminal domain of frataxin, the protein responsible for friedreich ataxia
Class: metal transport
Keywords: alpha-beta fold
Deposited on 1999-12-13, released 1999-12-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2002-06-26, with a file datestamp of 2007-04-25.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: frataxin
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q16595 (0-119)
  Domains in SCOPe 2.08: d1dlxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dlxA (A:)
  dettyerlaeetldslaeffedladkpytfedydvsfgsgvltvklggdlgtyvinkqtp
  nkqiwlsspssgpkrydwtgknwvyshdgvslhellaaeltkalktkldlsslaysgkda