PDB entry 1dlw

View 1dlw on RCSB PDB site
Description: x-ray crystal structure of truncated hemoglobin from p.caudatum.
Class: oxygen storage/transport
Keywords: globin fold truncated hemoglobin non vertebrate hemoglobin, oxygen storage/transport complex
Deposited on 1999-12-13, released 2000-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.133
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hemoglobin
  Species: Paramecium caudatum [TaxId:5885]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15160 (0-115)
  Domains in SCOPe 2.08: d1dlwa_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dlwA (A:)
  slfeqlggqaavqavtaqfyaniqadatvatffngidmpnqtnktaaflcaalggpnawt
  grnlkevhanmgvsnaqfttvighlrsaltgagvaaalveqtvavaetvrgdvvtv