PDB entry 1dlu

View 1dlu on RCSB PDB site
Description: unliganded biosynthetic thiolase from zoogloea ramigera
Class: transferase
Keywords: thiolase fold, transferase
Deposited on 1999-12-12, released 2000-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biosynthetic thiolase
    Species: ZOOGLOEA RAMIGERA [TaxId:350]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07097 (0-388)
      • insertion (7)
      • conflict (125)
    Domains in SCOPe 2.07: d1dlua1, d1dlua2
  • Chain 'B':
    Compound: biosynthetic thiolase
    Species: ZOOGLOEA RAMIGERA [TaxId:350]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07097 (0-388)
      • insertion (7)
      • conflict (125)
    Domains in SCOPe 2.07: d1dlub1, d1dlub2
  • Chain 'C':
    Compound: biosynthetic thiolase
    Species: ZOOGLOEA RAMIGERA [TaxId:350]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07097 (0-388)
      • insertion (7)
      • conflict (125)
    Domains in SCOPe 2.07: d1dluc1, d1dluc2
  • Chain 'D':
    Compound: biosynthetic thiolase
    Species: ZOOGLOEA RAMIGERA [TaxId:350]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07097 (0-388)
      • insertion (7)
      • conflict (125)
    Domains in SCOPe 2.07: d1dlud1, d1dlud2
  • Heterogens: SO4, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dluA (A:)
    siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
    qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
    hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
    nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
    gnasglndgaaaallmseaeasrrgiqplgrivswatvgvdpkvmgtgpipasrkalera
    gwkigdldlveaneafaaqacavnkdlgwdpsivnvnggaiaighpigasgarilntllf
    emkrrgarkglatlcigggmgvamciesl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dluB (B:)
    siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
    qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
    hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
    nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
    gnasglndgaaaallmseaeasrrgiqplgrivswatvgvdpkvmgtgpipasrkalera
    gwkigdldlveaneafaaqacavnkdlgwdpsivnvnggaiaighpigasgarilntllf
    emkrrgarkglatlcigggmgvamciesl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dluC (C:)
    siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
    qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
    hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
    nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
    gnasglndgaaaallmseaeasrrgiqplgrivswatvgvdpkvmgtgpipasrkalera
    gwkigdldlveaneafaaqacavnkdlgwdpsivnvnggaiaighpigasgarilntllf
    emkrrgarkglatlcigggmgvamciesl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dluD (D:)
    siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
    qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
    hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
    nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
    gnasglndgaaaallmseaeasrrgiqplgrivswatvgvdpkvmgtgpipasrkalera
    gwkigdldlveaneafaaqacavnkdlgwdpsivnvnggaiaighpigasgarilntllf
    emkrrgarkglatlcigggmgvamciesl