PDB entry 1dlt

View 1dlt on RCSB PDB site
Description: structure of catechol 1,2-dioxygenase from acinetobacter sp. adp1 with bound catechol
Deposited on 1999-12-12, released 2000-05-23
The last revision prior to the SCOP 1.57 freeze date was dated 2000-05-23, with a file datestamp of 2000-05-23.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1dlta_
  • Chain 'B':
    Domains in SCOP 1.57: d1dltb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dltA (A:)
    vkifntqdvqdflrvasgleqeggnprvkqiihrvlsdlykaiedlnitsdeywagvayl
    nqlganqeagllspglgfdhyldmrmdaedaalgienatprtiegplyvagapesvgyar
    mddgsdpnghtlilhgtifdadgkplpnakveiwhantkgfyshfdptgeqqafnmrrsi
    itdengqyrvrtilpagygcppegptqqllnqlgrhgnrpahihyfvsadghrklttqin
    vagdpytyddfayatreglvvdavehtdpeaikandvegpfaemvfdlkltrlvdgvdnq
    vvdrprlav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dltB (B:)
    vkifntqdvqdflrvasgleqeggnprvkqiihrvlsdlykaiedlnitsdeywagvayl
    nqlganqeagllspglgfdhyldmrmdaedaalgienatprtiegplyvagapesvgyar
    mddgsdpnghtlilhgtifdadgkplpnakveiwhantkgfyshfdptgeqqafnmrrsi
    itdengqyrvrtilpagygcppegptqqllnqlgrhgnrpahihyfvsadghrklttqin
    vagdpytyddfayatreglvvdavehtdpeaikandvegpfaemvfdlkltrlvdgvdnq
    vvdrprlav