PDB entry 1dlr

View 1dlr on RCSB PDB site
Description: methotrexate-resistant variants of human dihydrofolate reductase with substitution of leucine 22: kinetics, crystallography and potential as selectable markers
Class: oxido-reductase
Keywords: oxido-reductase
Deposited on 1995-01-25, released 1995-04-20
The last revision prior to the SCOP 1.75 freeze date was dated 1995-04-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.167
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: HOMO SAPIENS
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00374 (0-185)
      • conflict (21)
    Domains in SCOP 1.75: d1dlra_
  • Heterogens: NDP, MXA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dlrA (A:)
    vgslncivavsqnmgigkngdfpwpplrnefryfqrmtttssvegkqnlvimgkktwfsi
    peknrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv
    ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe
    vyeknd