PDB entry 1dlm

View 1dlm on RCSB PDB site
Description: structure of catechol 1,2-dioxygenase from acinetobacter calcoaceticus native data
Class: oxidoreductase
Keywords: metalloprotein, dioxygenase, aromatic compound degradation, mixed alpha helix/ beta strand, oxidoreductase
Deposited on 1999-12-11, released 2000-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catechol 1,2-dioxygenase
    Species: Acinetobacter sp. [TaxId:62977]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dlma_
  • Chain 'B':
    Compound: catechol 1,2-dioxygenase
    Species: Acinetobacter sp. [TaxId:62977]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dlmb_
  • Heterogens: FE, LIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dlmA (A:)
    mevkifntqdvqdflrvasgleqeggnprvkqiihrvlsdlykaiedlnitsdeywagva
    ylnqlganqeagllspglgfdhyldmrmdaedaalgienatprtiegplyvagapesvgy
    armddgsdpnghtlilhgtifdadgkplpnakveiwhantkgfyshfdptgeqqafnmrr
    siitdengqyrvrtilpagygcppegptqqllnqlgrhgnrpahihyfvsadghrklttq
    invagdpytyddfayatreglvvdavehtdpeaikandvegpfaemvfdlkltrlvdgvd
    nqvvdrprlav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dlmA (A:)
    vkifntqdvqdflrvasgleqeggnprvkqiihrvlsdlykaiedlnitsdeywagvayl
    nqlganqeagllspglgfdhyldmrmdaedaalgienatprtiegplyvagapesvgyar
    mddgsdpnghtlilhgtifdadgkplpnakveiwhantkgfyshfdptgeqqafnmrrsi
    itdengqyrvrtilpagygcppegptqqllnqlgrhgnrpahihyfvsadghrklttqin
    vagdpytyddfayatreglvvdavehtdpeaikandvegpfaemvfdlkltrlvdgvdnq
    vvdrprlav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dlmB (B:)
    mevkifntqdvqdflrvasgleqeggnprvkqiihrvlsdlykaiedlnitsdeywagva
    ylnqlganqeagllspglgfdhyldmrmdaedaalgienatprtiegplyvagapesvgy
    armddgsdpnghtlilhgtifdadgkplpnakveiwhantkgfyshfdptgeqqafnmrr
    siitdengqyrvrtilpagygcppegptqqllnqlgrhgnrpahihyfvsadghrklttq
    invagdpytyddfayatreglvvdavehtdpeaikandvegpfaemvfdlkltrlvdgvd
    nqvvdrprlav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dlmB (B:)
    vkifntqdvqdflrvasgleqeggnprvkqiihrvlsdlykaiedlnitsdeywagvayl
    nqlganqeagllspglgfdhyldmrmdaedaalgienatprtiegplyvagapesvgyar
    mddgsdpnghtlilhgtifdadgkplpnakveiwhantkgfyshfdptgeqqafnmrrsi
    itdengqyrvrtilpagygcppegptqqllnqlgrhgnrpahihyfvsadghrklttqin
    vagdpytyddfayatreglvvdavehtdpeaikandvegpfaemvfdlkltrlvdgvdnq
    vvdrprlav