PDB entry 1dlk

View 1dlk on RCSB PDB site
Description: crystal structure analysis of delta-chymotrypsin bound to a peptidyl chloromethyl ketone inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: Delta-chymotrypsin, peptidic inhibior, chloromethyl ketone, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1999-12-10, released 2000-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.206
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thrombin light chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dlk.1
  • Chain 'B':
    Compound: Thrombin heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dlk.1
  • Chain 'C':
    Compound: Thrombin light chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dlk.2
  • Chain 'D':
    Compound: Thrombin heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dlk.2
  • Chain 'E':
    Compound: peptidic inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1DLK (0-4)
  • Chain 'F':
    Compound: peptidic inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1DLK (0-4)
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dlkA (A:)
    cgvpaiqpvlsgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dlkB (B:)
    ivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsdvvvagefdqgs
    ssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclpsasddfaagtt
    cvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdamicagasgvsscmgds
    ggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dlkC (C:)
    cgvpaiqpvlsgl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dlkD (D:)
    ivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsdvvvagefdqgs
    ssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclpsasddfaagtt
    cvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdamicagasgvsscmgds
    ggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.