PDB entry 1dlj

View 1dlj on RCSB PDB site
Description: the first structure of udp-glucose dehydrogenase (udpgdh) reveals the catalytic residues necessary for the two-fold oxidation
Deposited on 1999-12-09, released 2000-05-31
The last revision prior to the SCOP 1.57 freeze date was dated 2000-06-21, with a file datestamp of 2000-06-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dljA (A:)
    mkiavagsgyvglslgvllslqnevtivdilpskvdkinnglspiqdeyieyylkskqls
    ikatldskaaykeaelviiatptnynsrinyfdtqhvetvikevlsvnshatliikstip
    igfitemrqkfqtdriifspeflreskalydnlypsriivsceendspkvkadaekfall
    lksaakknnvpvlimgaseaeavklfantylalrvayfneldtyaesrklnshmiiqgis
    yddrigmhynnpsfgyggyslpkdtkqllanynnipqtlieaivssnnvrksyiakqiin
    vlkeqespvkvvgvyrlimksnsdnfresaikdvidilkskdikiiiyepmlnklesedq
    svlvndlenfkkqaniivtnrydnelqdvknkvysrdifgrd