PDB entry 1dlj

View 1dlj on RCSB PDB site
Description: the first structure of udp-glucose dehydrogenase (udpgdh) reveals the catalytic residues necessary for the two-fold oxidation
Class: oxidoreductase
Keywords: rossmann fold, ternary complex, crystallographic dimer, oxidoreductase
Deposited on 1999-12-09, released 2000-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-glucose dehydrogenase
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C0F4 (0-401)
      • engineered (259)
    Domains in SCOPe 2.07: d1dlja1, d1dlja2, d1dlja3
  • Heterogens: SO4, NAI, UGA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dljA (A:)
    mkiavagsgyvglslgvllslqnevtivdilpskvdkinnglspiqdeyieyylkskqls
    ikatldskaaykeaelviiatptnynsrinyfdtqhvetvikevlsvnshatliikstip
    igfitemrqkfqtdriifspeflreskalydnlypsriivsceendspkvkadaekfall
    lksaakknnvpvlimgaseaeavklfantylalrvayfneldtyaesrklnshmiiqgis
    yddrigmhynnpsfgyggyslpkdtkqllanynnipqtlieaivssnnvrksyiakqiin
    vlkeqespvkvvgvyrlimksnsdnfresaikdvidilkskdikiiiyepmlnklesedq
    svlvndlenfkkqaniivtnrydnelqdvknkvysrdifgrd