PDB entry 1dlg

View 1dlg on RCSB PDB site
Description: crystal structure of the c115s enterobacter cloacae mura in the un- liganded state
Deposited on 1999-12-09, released 2000-04-12
The last revision prior to the SCOP 1.55 freeze date was dated 2000-04-12, with a file datestamp of 2000-04-12.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.173
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dlga_
  • Chain 'B':
    Domains in SCOP 1.55: d1dlgb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dlgA (A:)
    mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
    gtkverxgsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggsaigar
    pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
    iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
    aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
    afptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
    sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dlgA (A:)
    mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
    gtkvergsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggsaigarp
    vdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtti
    ienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflva
    aaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphpa
    fptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekls
    gaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dlgB (B:)
    mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
    gtkverxgsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggsaigar
    pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
    iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
    aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
    afptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
    sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dlgB (B:)
    mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
    gtkvergsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggsaigarp
    vdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtti
    ienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflva
    aaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphpa
    fptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekls
    gaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge