PDB entry 1dlf

View 1dlf on RCSB PDB site
Description: high resolution crystal structure of the fv fragment from an anti-dansyl switch variant antibody igg2a(s) crystallized at ph 5.25
Class: immunoglobulin
Keywords: fv fragment, immunoglobulin
Deposited on 1998-07-14, released 1999-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.183
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: anti-dansyl immunoglobulin igg2a(s)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR PC1213 (0-End)
      • conflict (23)
      • conflict (48)
      • conflict (51)
      • conflict (78-79)
      • conflict (84)
      • conflict (99)
      • insertion (101)
      • conflict (102-105)
    Domains in SCOPe 2.08: d1dlfh_
  • Chain 'L':
    Compound: anti-dansyl immunoglobulin igg2a(s)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JL82 (0-112)
      • conflict (16)
      • conflict (100)
      • conflict (104)
    Domains in SCOPe 2.08: d1dlfl_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1dlfH (H:)
    evkleesggglvqpggsmklscatsgftfsdawmdwvrqspekglewvaeirnkannhat
    yyaesvkgrftisrddskrrvylqmntlraedtgiyyctgiyyhypwfaywgqgtlvtvs
    aepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dlfH (H:)
    evkleesggglvqpggsmklscatsgftfsdawmdwvrqspekglewvaeirnkannhat
    yyaesvkgrftisrddskrrvylqmntlraedtgiyyctgiyyhypwfaywgqgtlvtvs
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dlfL (L:)
    dvvmtqtplslpvslgnqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtkleikr