PDB entry 1dle

View 1dle on RCSB PDB site
Description: factor b serine protease domain
Class: hydrolase
Keywords: serine protease, complement system, factor b, protein-protein interaction, activation mechanism, beta-barrel fold, , hydrolase
Deposited on 1999-12-09, released 2000-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement factor b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00751 (11-297)
      • insertion (11)
      • insertion (11)
      • insertion (11)
    Domains in SCOPe 2.07: d1dlea_
  • Chain 'B':
    Compound: complement factor b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00751 (11-297)
      • insertion (11)
      • insertion (11)
      • insertion (11)
    Domains in SCOPe 2.07: d1dleb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dleA (A:)
    adpdesqslslcgmvwehrkgtdyhkqpwqakisvirpskghescmgavvseyfvltaah
    cftvddkehsikvsvggekrdleievvlfhpnyningkkeagipefydydvaliklknkl
    kygqtirpiclpctegttralrlpptttcqqqkeellpaqdikalfvseeekkltrkevy
    ikngdkkgscerdaqyapgydkvkdisevvtprflctggvspyadpntcrgdsggplivh
    krsrfiqvgviswgvvdvcknqkrqkqvpahardfhinlfqvlpwlkeklqdedlgfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dleA (A:)
    adpdesqslslcgmvkgtdyhkqpwqakisvirpskghescmgavvseyfvltaahcftv
    ddkehsikvsvggekrdleievvlfhpnyningkkeagipefydydvaliklknklkygq
    tirpiclpctegttralrlpptttcqqqkeellpaqdikalfvseeekkltrkevyikng
    dkkgscerdaqyapgydkvkdisevvtprflctggvspyadpntcrgdsggplivhkrsr
    fiqvgviswgvvdvckqvpahardfhinlfqvlpwlkeklqdedlgfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dleB (B:)
    adpdesqslslcgmvwehrkgtdyhkqpwqakisvirpskghescmgavvseyfvltaah
    cftvddkehsikvsvggekrdleievvlfhpnyningkkeagipefydydvaliklknkl
    kygqtirpiclpctegttralrlpptttcqqqkeellpaqdikalfvseeekkltrkevy
    ikngdkkgscerdaqyapgydkvkdisevvtprflctggvspyadpntcrgdsggplivh
    krsrfiqvgviswgvvdvcknqkrqkqvpahardfhinlfqvlpwlkeklqdedlgfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dleB (B:)
    slcgmvwehrkgtdyhkqpwqakisvirpskghescmgavvseyfvltaahcftvddkeh
    sikvsvggekrdleievvlfhpnyningkkeagipefydydvaliklknklkygqtirpi
    clpctegttralrlpptttcqqqkeellpaqdikalfvseeekkltrkevyikngdkkgs
    cerdaqyapgydkvkdisevvtprflctggvspyadpntcrgdsggplivhkrsrfiqvg
    viswgvvdvckvpahardfhinlfqvlpwlkeklqdedlgfl