PDB entry 1dlc

View 1dlc on RCSB PDB site
Description: crystal structure of insecticidal delta-endotoxin from bacillus thuringiensis at 2.5 angstroms resolution
Class: toxin
Keywords: toxin
Deposited on 1994-06-22, released 1994-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.183
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta-endotoxin cryiiia
    Species: BACILLUS THURINGIENSIS [TaxId:1428]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dlca1, d1dlca2, d1dlca3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dlcA (A:)
    ttkdviqkgisvvgdllgvvgfpfggalvsfytnflntiwpsedpwkafmeqvealmdqk
    iadyaknkalaelqglqnnvedyvsalsswqknpvssrnphsqgrirelfsqaeshfrns
    mpsfaisgyevlflttyaqaanthlfllkdaqiygeewgyekediaefykrqlkltqeyt
    dhcvkwynvgldklrgssyeswvnfnryrremtltvldlialfplydvrlypkevktelt
    rdvltdpivgvnnlrgygttfsnienyirkphlfdylhriqfhtrfqpgyygndsfnyws
    gnyvstrpsigsndiitspfygnkssepvqnlefngekvyravantnlavwpsavysgvt
    kvefsqyndqtdeastqtydskrnvgavswdsidqlppettdeplekgyshqlnyvmcfl
    mqgsrgtipvltwthksvdffnmidskkitqlplvkayklqsgasvvagprftggdiiqc
    tengsaatiyvtpdvsysqkyrarihyastsqitftlsldgapfnqyyfdktinkgdtlt
    ynsfnlasfstpfelsgnnlqigvtglsagdkvyidkiefipvn