PDB entry 1dlb

View 1dlb on RCSB PDB site
Description: helical interactions in the hiv-1 gp41 core reveals structural basis for the inhibitory activity of gp41 peptides
Deposited on 1999-12-09, released 1999-12-15
The last revision was dated 2021-11-03, with a file datestamp of 2021-10-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 envelope glycoprotein gp41
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04578 (40-67)
      • see remark 999 (34-39)
      • engineered mutation (64)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.55, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1dlbA (A:)
sgivqqqnnllraieaqqhllqltvwgikqlqarsggrggwmewdreinnytslihslie
esqnlqek

    Sequence, based on observed residues (ATOM records):
    >1dlbA (A:)
givqqqnnllraieaqqhllqltvwgikqlqarsrggwmewdreinnytslihslieesq
nlq