PDB entry 1dl7

View 1dl7 on RCSB PDB site
Description: the structural basis of repertoire shift in an immune response to phosphocholine
Class: immune system
Keywords: single chain fv, repertoire shift, immune system
Deposited on 1999-12-08, released 2000-12-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.191
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: protein (antibody m3c65 (heavy chain))
    Species: Homo sapiens [TaxId:9606]
    Gene: HYBRIDOMA M3C65
    Database cross-references and differences (RAF-indexed):
    • PDB 1DL7 (0-111)
    Domains in SCOPe 2.01: d1dl7h_
  • Chain 'L':
    Compound: protein (antibody m3c65 (light chain))
    Species: Homo sapiens [TaxId:9606]
    Gene: HYBRIDOMA M3C65
    Database cross-references and differences (RAF-indexed):
    • PDB 1DL7 (0-108)
    Domains in SCOPe 2.01: d1dl7l_
  • Heterogens: NCH, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dl7H (H:)
    qvqlkesgpglvapsqslsitctvsgfsltgygvnwvrqppgkglewlgmiwgdgstdyn
    salksrlniskdksksqvflrmyslqtddtaryycardygpywgqgtlvtvs
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dl7L (L:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtkhrtpga
    parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl