PDB entry 1dl7

View 1dl7 on RCSB PDB site
Description: the structural basis of repertoire shift in an immune response to phosphocholine
Deposited on 1999-12-08, released 2000-12-13
The last revision prior to the SCOP 1.67 freeze date was dated 2000-12-13, with a file datestamp of 2000-12-13.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Domains in SCOP 1.67: d1dl7h_
  • Chain 'L':
    Domains in SCOP 1.67: d1dl7l_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dl7H (H:)
qvqlkesgpglvapsqslsitctvsgfsltgygvnwvrqppgkglewlgmiwgdgstdyn
salksrlniskdksksqvflrmyslqtddtaryycardygpywgqgtlvtvs

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dl7L (L:)
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtkhrtpga
parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl