PDB entry 1dl6

View 1dl6 on RCSB PDB site
Description: solution structure of human tfiib n-terminal domain
Class: gene regulation
Keywords: zinc ribbon, gene regulation
Deposited on 1999-12-08, released 2000-10-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor II b (tfiib)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dl6a_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dl6A (A:)
    astsrldalprvtcpnhpdailvedyragdmicpecglvvgdrvidvgsewrtfsndk