PDB entry 1dl3

View 1dl3 on RCSB PDB site
Description: crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima
Class: isomerase
Keywords: x-ray structure, isomerase, oligomerisation, thermostability, thermotoga maritima, protein engineering, dimer evolution
Deposited on 1999-12-08, released 1999-12-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.175
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (phosphoribosylantranilate isomerase)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56320
      • mutation (24)
      • mutation (52)
      • mutation (98)
    Domains in SCOPe 2.07: d1dl3a_
  • Chain 'B':
    Compound: protein (phosphoribosylantranilate isomerase)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56320 (0-202)
      • mutation (24)
      • mutation (52)
      • mutation (98)
    Domains in SCOPe 2.07: d1dl3b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dl3A (A:)
    mvrvkicgitnledalfsvesgadyvgfvfypkskryispedarrisvelpvervgvfvn
    eepekildvasyvqlnavqlhgeepielcrkiaerilvwkavgvsnerdmeralnyrefp
    illdtktpeyggsgktfdwslilpyrdrfrylvlsgglnpenvrsaidvvrpfavdvssg
    veafpgkkdhdsikmfiknakgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dl3A (A:)
    mvrvkicgitnledalfsvesgadyvgfvfypkskryispedarrisvelpvervgvfvn
    eepekildvasyvqlnavqlhgeepielcrkiaerilvwkavgvsnerdmeralnyrefp
    illdtdwslilpyrdrfrylvlsgglnpenvrsaidvvrpfavdvssgveafpgkkdhds
    ikmfiknakgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dl3B (B:)
    mvrvkicgitnledalfsvesgadyvgfvfypkskryispedarrisvelpvervgvfvn
    eepekildvasyvqlnavqlhgeepielcrkiaerilvwkavgvsnerdmeralnyrefp
    illdtktpeyggsgktfdwslilpyrdrfrylvlsgglnpenvrsaidvvrpfavdvssg
    veafpgkkdhdsikmfiknakgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dl3B (B:)
    mvrvkicgitnledalfsvesgadyvgfvfypkskryispedarrisvelpvervgvfvn
    eepekildvasyvqlnavqlhgeepielcrkiaerilvwkavgvsnerdmeralnyrefp
    illdtktfdwslilpyrdrfrylvlsgglnpenvrsaidvvrpfavdvssgveafpgkkd
    hdsikmfiknakgl