PDB entry 1dl2

View 1dl2 on RCSB PDB site
Description: crystal structure of class I alpha-1,2-mannosidase from saccharomyces cerevisiae at 1.54 angstrom resolution
Class: hydrolase
Keywords: alpha-alpha helix barrel, hydrolase
Deposited on 1999-12-08, released 2000-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: class I alpha-1,2-mannosidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dl2a_
  • Heterogens: NAG, NDG, BMA, MAN, CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dl2A (A:)
    gagemrdriesmfleswrdyskhgwgydvygpiehtshnmprgnqplgwiivdsvdtlml
    mynsstlyksefeaeiqrsehwindvldfdidaevnvfettirmlggllsayhlsdvlev
    gnktvylnkaidlgdrlalaflstqtgipyssinlhsgqavknhadggasstaefttlqm
    efkylayltgnrtywelvervyeplyknndllntydglvpiytfpdtgkfgastirfgsr
    gdsfyeyllkqyllthetlyydlyrksmegmkkhllaqskpsslwyigereqglhgqlsp
    kmdhlvcfmggllasgsteglsihearrrpffsksdwdlakgitdtcyqmykqsssglap
    eivvfndgnikqdgwwrssvgdffvkpldrhnlqrpetvesimfmyhlshdhkyrewgae
    iatsffentcvdcndpklrrftslsdcitlptkksnnmesfwlaetlkylyilfldefdl
    tkvvfnteahpfpvldeeilksqslttgwsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dl2A (A:)
    gagemrdriesmfleswrdyskhgwgydvygpiehtshnmprgnqplgwiivdsvdtlml
    mynsstlyksefeaeiqrsehwindvldfdidaevnvfettirmlggllsayhlsdvlev
    gnktvylnkaidlgdrlalaflstqtgipyssinlhsgqavknhadggasstaefttlqm
    efkylayltgnrtywelvervyeplyknndllntydglvpiytfpdtgkfgastirfgsr
    gdsfyeyllkqyllthetlyydlyrksmegmkkhllaqskpsslwyigereqglhgqlsp
    kmdhlvcfmggllasgsteglsihearrrpffsksdwdlakgitdtcyqmykqsssglap
    eivvfndgnikdgwwrssvgdffvkpldrhnlqrpetvesimfmyhlshdhkyrewgaei
    atsffentcvdcndpklrrftslsdcitlptkksnnmesfwlaetlkylyilfldefdlt
    kvvfnteahpfpvldeeilksqslttgwsl