PDB entry 1dkz

View 1dkz on RCSB PDB site
Description: the substrate binding domain of dnak in complex with a substrate peptide, determined from type 1 native crystals
Class: complex (molecular chaperone/peptide)
Keywords: DNAK, HEAT SHOCK PROTEIN 70 KDA (HSP70), COMPLEX (MOLECULAR CHAPERONE-PEPTIDE), COMPLEX (MOLECULAR CHAPERONE-PEPTIDE) complex
Deposited on 1996-06-03, released 1996-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: substrate binding domain of dnak
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6Y8 (0-End)
      • conflict (48)
    Domains in SCOPe 2.07: d1dkza1, d1dkza2
  • Chain 'B':
    Compound: substrate peptide (7 residues)
    Database cross-references and differences (RAF-indexed):
    • PDB 1DKZ (0-6)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dkzA (A:)
    vllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavsihvlqgerkra
    adnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassgln
    edeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaiesa
    ltaletalkgedkaaieakmqelaqvsqklmeiaqqqha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dkzA (A:)
    vllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavsihvlqgerkra
    adnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassgln
    edeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaiesa
    ltaletalkgedkaaieakmqelaqvsqklmeiaq
    

  • Chain 'B':
    No sequence available.