PDB entry 1dky

View 1dky on RCSB PDB site
Description: the substrate binding domain of dnak in complex with a substrate peptide, determined from type 2 native crystals
Class: complex (molecular chaperone/peptide)
Keywords: dnak, heat shock protein 70 kda (hsp70), complex (molecular chaperone/peptide)
Deposited on 1996-06-03, released 1996-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.225
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dnak
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6Y8 (0-End)
      • conflict (48)
    Domains in SCOPe 2.07: d1dkya1, d1dkya2
  • Chain 'B':
    Compound: dnak
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6Y8 (0-End)
      • conflict (48)
    Domains in SCOPe 2.07: d1dkyb1, d1dkyb2
  • Chain 'C':
    Compound: peptide substrate
    Database cross-references and differences (RAF-indexed):
    • PDB 1DKY
  • Chain 'D':
    Compound: peptide substrate
    Database cross-references and differences (RAF-indexed):
    • PDB 1DKY
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dkyA (A:)
    vllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavsihvlqgerkra
    adnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassgln
    edeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaiesa
    ltaletalkgedkaaieakmqelaqvsqklmeiaqqqha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dkyA (A:)
    vllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavsihvlqgerkra
    adnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassgln
    edeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaiesa
    ltaletalkgedkaaieakmqelaqvsqklm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dkyB (B:)
    vllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavsihvlqgerkra
    adnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassgln
    edeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaiesa
    ltaletalkgedkaaieakmqelaqvsqklmeiaqqqha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dkyB (B:)
    vllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavsihvlqgerkra
    adnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassgln
    edeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaiesa
    ltaletalkgedkaaieakmqel
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.