PDB entry 1dkw

View 1dkw on RCSB PDB site
Description: crystal structure of triose-phosphate isomerase with modified substrate binding site
Class: isomerase
Keywords: tim barrel, modified loop-8, isomerase
Deposited on 1999-12-08, released 2000-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.186
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dkwa_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dkwb_
  • Heterogens: TBU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dkwA (A:)
    skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
    aaqnagnedslpslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
    tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
    irswvsskigadvagelrilyggsvngknartlyqqrdvngflvglkpefvdiikatq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dkwB (B:)
    skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
    aaqnagnedslpslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
    tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
    irswvsskigadvagelrilyggsvngknartlyqqrdvngflvglkpefvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dkwB (B:)
    skpqpiaaanwkdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfviaaqn
    agnedslpslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacigetlqe
    resgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahalirsw
    vsskigadvagelrilyggsvngknartlyqqrdvngflvglkpefvdiikatq