PDB entry 1dkq

View 1dkq on RCSB PDB site
Description: crystal structure of phytate complex escherichia coli phytase at ph 5.0. phytate is bound with its 3-phosphate in the active site. hg2+ cation acts as an intermolecular bridge
Class: hydrolase
Keywords: histidine acid phosphatase fold, hydrolase
Deposited on 1999-12-08, released 2000-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.217
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phytase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07102 (0-409)
      • engineered (16)
      • engineered (115)
    Domains in SCOPe 2.06: d1dkqa_
  • Heterogens: HG, IHP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dkqA (A:)
    qsepelklesvvivsragvraptkatqlmqdvtpdawptwpvklgwltprggeliaylgh
    yqrqrlvadgllakkgcpqsgqvaiiadvdertrktgeafaaglapdcaitvhtqtdtss
    pdplfnplktgvcqldnanvtdailsraggsiadftghrqtafrelervlnfpqsnlclk
    rekqdescsltqalpselkvsadnvsltgavslasmlteifllqqaqgmpepgwgritds
    hqwntllslhnaqfyllqrtpevarsratplldliktaltphppqkqaygvtlptsvlfi
    aghdtnlanlggalelnwtlpgqpdntppggelvferwrrlsdnsqwiqvslvfqtlqqm
    rdktplslntppgevkltlagceernaqgmcslagftqivnearipacsl