PDB entry 1dkl

View 1dkl on RCSB PDB site
Description: crystal structure of escherichia coli phytase at ph 4.5 (no ligand bound)
Class: hydrolase
Keywords: histidine acid phosphatase fold, hydrolase
Deposited on 1999-12-08, released 2000-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.157
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phytase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dkla_
  • Chain 'B':
    Compound: phytase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dklb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dklA (A:)
    qsepelklesvvivsrhgvraptkatqlmqdvtpdawptwpvklgwltprggeliaylgh
    yqrqrlvadgllakkgcpqsgqvaiiadvdertrktgeafaaglapdcaitvhtqadtss
    pdplfnplktgvcqldnanvtdailsraggsiadftghrqtafrelervlnfpqsnlclk
    rekqdescsltqalpselkvsadnvsltgavslasmlteifllqqaqgmpepgwgritds
    hqwntllslhnaqfyllqrtpevarsratplldliktaltphppqkqaygvtlptsvlfi
    aghdtnlanlggalelnwtlpgqpdntppggelvferwrrlsdnsqwiqvslvfqtlqqm
    rdktplslntppgevkltlagceernaqgmcslagftqivnearipacsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dklA (A:)
    sepelklesvvivsrhgvraptkatqlmqdvtpdawptwpvklgwltprggeliaylghy
    qrqrlvadgllakkgcpqsgqvaiiadvdertrktgeafaaglapdcaitvhtqadtssp
    dplfnplktgvcqldnanvtdailsraggsiadftghrqtafrelervlnfpqsnlclkr
    scsltqalpselkvsadnvsltgavslasmlteifllqqaqgmpepgwgritdshqwntl
    lslhnaqfyllqrtpevarsratplldliktaltphppqkqaygvtlptsvlfiaghdtn
    lanlggalelnwtlpgqpdntppggelvferwrrlsdnsqwiqvslvfqtlqqmrdktpl
    slntppgevkltlagceernaqgmcslagftqivnearipacsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dklB (B:)
    qsepelklesvvivsrhgvraptkatqlmqdvtpdawptwpvklgwltprggeliaylgh
    yqrqrlvadgllakkgcpqsgqvaiiadvdertrktgeafaaglapdcaitvhtqadtss
    pdplfnplktgvcqldnanvtdailsraggsiadftghrqtafrelervlnfpqsnlclk
    rekqdescsltqalpselkvsadnvsltgavslasmlteifllqqaqgmpepgwgritds
    hqwntllslhnaqfyllqrtpevarsratplldliktaltphppqkqaygvtlptsvlfi
    aghdtnlanlggalelnwtlpgqpdntppggelvferwrrlsdnsqwiqvslvfqtlqqm
    rdktplslntppgevkltlagceernaqgmcslagftqivnearipacsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dklB (B:)
    pelklesvvivsrhgvraptkatqlmqdvtpdawptwpvklgwltprggeliaylghyqr
    qrlvadgllakkgcpqsgqvaiiadvdertrktgeafaaglapdcaitvhtqadtsspdp
    lfnplktgvcqldnanvtdailsraggsiadftghrqtafrelervlnfpqsnlclkrsc
    sltqalpselkvsadnvsltgavslasmlteifllqqaqgmpepgwgritdshqwntlls
    lhnaqfyllqrtpevarsratplldliktaltphppqkqaygvtlptsvlfiaghdtnla
    nlggalelnwtlpgqpdntppggelvferwrrlsdnsqwiqvslvfqtlqqmrdktplsl
    ntppgevkltlagceernaqgmcslagftqivnearipacsl