PDB entry 1dkk

View 1dkk on RCSB PDB site
Description:
Deposited on 1996-01-10, released 1996-07-11
The last revision prior to the SCOP 1.63 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.157
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1dkka_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1dkkb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dkkA (A:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
    rwwcndgktpgsrnlcnipcsallssditatvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dkkB (B:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
    rwwcndgktpgsrnlcnipcsallssditatvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl