PDB entry 1dkj

View 1dkj on RCSB PDB site
Description: bobwhite quail lysozyme
Class: hydrolase (o-glycosyl)
Keywords: hydrolase, glycosidase, bacteriolytic enzyme, hydrolase (o-glycosyl)
Deposited on 1996-01-10, released 1996-07-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Colinus virginianus [TaxId:9014]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dkja_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dkjA (A:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
    rwwcndgktpgsrnlcnipcsallssditatvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl