PDB entry 1dki

View 1dki on RCSB PDB site
Description: crystal structure of the zymogen form of streptococcal pyrogenic exotoxin b active site (c47s) mutant
Class: toxin
Keywords: zymogen, cysteine protease, papain-like, toxin
Deposited on 1999-12-07, released 2000-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.218
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyrogenic exotoxin b zymogen
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dkia_
  • Chain 'B':
    Compound: pyrogenic exotoxin b zymogen
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dkib_
  • Chain 'C':
    Compound: pyrogenic exotoxin b zymogen
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dkic_
  • Chain 'D':
    Compound: pyrogenic exotoxin b zymogen
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dkid_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dkiA (A:)
    dqnfarnekeakdsaitfiqksaaikagarsaedikldkvnlggelsgsnmyvynistgg
    fvivsgdkrspeilgystsgsfdvngkeniasfmesyveqikenkkldstyagtaeikqp
    vvkslldskgihynqgnpynlltpviekvkpgeqsfvgqhaatgsvatataqimkyhnyp
    nkglkdytytlssnnpyfnhpknlfaaistrqynwnnilptysgresnvqkmaiselmad
    vgisvdmdygpssgsagssrvqralkenfgynqsvhqinrgdfskqdweaqidkelsqnq
    pvyyqgvgkvgghafvidgadgrnfyhvnwgwggvsdgffrldalnpsalgtgggaggfn
    gyqsavvgikp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dkiA (A:)
    ldkvnlggelsgsnmyvyngfvivsgdkrspeilgystsgsfdvngkeniasfmesyveq
    ikenkklpvvkslldskgihynqgnpynlltpviekvkpgeqsfvgqhaatgsvatataq
    imkyhnypnkglkdytytlssnnpyfnhpknlfaaistrqynwnnilptysgresnvqkm
    aiselmadvgisvdmdygpssgsagssrvqralkenfgynqsvhqinrgdfskqdweaqi
    dkelsqnqpvyyqgvgkvgghafvidgadgrnfyhvnwgwggvsdgffrldalyqsavvg
    ikp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dkiB (B:)
    dqnfarnekeakdsaitfiqksaaikagarsaedikldkvnlggelsgsnmyvynistgg
    fvivsgdkrspeilgystsgsfdvngkeniasfmesyveqikenkkldstyagtaeikqp
    vvkslldskgihynqgnpynlltpviekvkpgeqsfvgqhaatgsvatataqimkyhnyp
    nkglkdytytlssnnpyfnhpknlfaaistrqynwnnilptysgresnvqkmaiselmad
    vgisvdmdygpssgsagssrvqralkenfgynqsvhqinrgdfskqdweaqidkelsqnq
    pvyyqgvgkvgghafvidgadgrnfyhvnwgwggvsdgffrldalnpsalgtgggaggfn
    gyqsavvgikp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dkiB (B:)
    arnekeakdkvnlggelsgsnmyvynistggfvivsgdkrspeilgystsgsfdvngken
    iasfmesyveqikenkklqpvvkslldskgihynqgnpynlltpviekvkpgeqsfvgqh
    aatgsvatataqimkyhnypnkglkdytytlssnnpyfnhpknlfaaistrqynwnnilp
    tysgresnvqkmaiselmadvgisvdmdygpssgsagssrvqralkenfgynqsvhqinr
    gdfskqdweaqidkelsqnqpvyyqgvgkvgghafvidgadgrnfyhvnwgwggvsdgff
    rldalnpfngyqsavvgikp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dkiC (C:)
    dqnfarnekeakdsaitfiqksaaikagarsaedikldkvnlggelsgsnmyvynistgg
    fvivsgdkrspeilgystsgsfdvngkeniasfmesyveqikenkkldstyagtaeikqp
    vvkslldskgihynqgnpynlltpviekvkpgeqsfvgqhaatgsvatataqimkyhnyp
    nkglkdytytlssnnpyfnhpknlfaaistrqynwnnilptysgresnvqkmaiselmad
    vgisvdmdygpssgsagssrvqralkenfgynqsvhqinrgdfskqdweaqidkelsqnq
    pvyyqgvgkvgghafvidgadgrnfyhvnwgwggvsdgffrldalnpsalgtgggaggfn
    gyqsavvgikp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dkiC (C:)
    farnekeakdsaitfiqkikldkvnlggelsgsnmyvynistggfvivsgdkrspeilgy
    stsgsfdvngkeniasfmesyveqikenkkldstyaqpvvkslldskgihynqgnpynll
    tpviekvkpgeqsfvgqhaatgsvatataqimkyhnypnkglkdytytlssnnpyfnhpk
    nlfaaistrqynwnnilptysgresnvqkmaiselmadvgisvdmdygpssgsagssrvq
    ralkenfgynqsvhqinrgdfskqdweaqidkelsqnqpvyyqgvgkvgghafvidgadg
    rnfyhvnwgwggvsdgffrldalnpgfngyqsavvgikp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dkiD (D:)
    dqnfarnekeakdsaitfiqksaaikagarsaedikldkvnlggelsgsnmyvynistgg
    fvivsgdkrspeilgystsgsfdvngkeniasfmesyveqikenkkldstyagtaeikqp
    vvkslldskgihynqgnpynlltpviekvkpgeqsfvgqhaatgsvatataqimkyhnyp
    nkglkdytytlssnnpyfnhpknlfaaistrqynwnnilptysgresnvqkmaiselmad
    vgisvdmdygpssgsagssrvqralkenfgynqsvhqinrgdfskqdweaqidkelsqnq
    pvyyqgvgkvgghafvidgadgrnfyhvnwgwggvsdgffrldalnpsalgtgggaggfn
    gyqsavvgikp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dkiD (D:)
    farnekeakdsaitfiqkldkvnlggelsgsnmyvynistggfvivsgdkrspeilgyst
    sgsfdvngkeniasfmesyveqikenkkldstyagqpvvkslldskgihynqgnpynllt
    pviekvkpgeqsfvgqhaatgsvatataqimkyhnypnkglkdytytlssnnpyfnhpkn
    lfaaistrqynwnnilptysgresnvqkmaiselmadvgisvdmdygpssgsagssrvqr
    alkenfgynqsvhqinrgdfskqdweaqidkelsqnqpvyyqgvgkvgghafvidgadgr
    nfyhvnwgwggvsdgffrldalnpyqsavvgikp