PDB entry 1dkf

View 1dkf on RCSB PDB site
Description: crystal structure of a heterodimeric complex of rar and rxr ligand- binding domains
Deposited on 1999-12-07, released 2000-04-19
The last revision prior to the SCOP 1.71 freeze date was dated 2000-04-26, with a file datestamp of 2000-04-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.203
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1dkfa_
  • Chain 'B':
    Domains in SCOP 1.71: d1dkfb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dkfA (A:)
    sanedmpvekileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewak
    riphfselplddqvillragwnelliasashrsiavkdgillatglhvhrnsahsagvga
    ifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayc
    khkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemlea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dkfA (A:)
    sanedmpvekileaelaveppndpvtnicqaadkqlftlvewakriphfselplddqvil
    lragwnelliasashrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdm
    qmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklll
    rlpalrsiglkclehlfffkligdtpidtflmemlea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dkfB (B:)
    pevgeliekvrkahqetfpalcqlgkyttnnsseqrvsldidlwdkfselstkciiktve
    fakqlpgfttltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrtqmhnag
    fgpltdlvfafanqllplemddaetgllsaiclicgdrqdleqpdrvdmlqepllealkv
    yvrkrrpsrphmfpkmlmkitdlrsisakgaervitlkmeipgsmppliqemlen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dkfB (B:)
    pevgeliekvrkahqetfpalcqlgkyttseqrvsldidlwdkfselstkciiktvefak
    qlpgfttltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrtqmhnagfgp
    ltdlvfafanqllplemddaetgllsaiclicgdrqdleqpdrvdmlqepllealkvyvr
    krrpsrphmfpkmlmkitdlrsisakgaervitlkmeipgsmppliqemlen