PDB entry 1dkd

View 1dkd on RCSB PDB site
Description: crystal structure of a groEL (apical domain) and a dodecameric peptide complex
Class: chaperone
Keywords: molecular chaperon, hsp60, protein folding, peptide selection, phage display, peptide binding groove formed by paired helices substrate peptide in beta-sheet, chaperone
Deposited on 1999-12-07, released 2000-01-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.215
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: groEL
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A6F5 (0-145)
  Domains in SCOPe 2.06: d1dkda_
• Chain 'B':
  Compound: groEL
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A6F5 (0-145)
  Domains in SCOPe 2.06: d1dkdb_
• Chain 'C':
  Compound: groEL
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A6F5 (0-145)
  Domains in SCOPe 2.06: d1dkdc_
• Chain 'D':
  Compound: groEL
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A6F5 (0-145)
  Domains in SCOPe 2.06: d1dkdd_
• Chain 'E':
  Compound: 12-mer peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1DKD (Start-11)
• Chain 'F':
  Compound: 12-mer peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1DKD (Start-11)
• Chain 'G':
  Compound: 12-mer peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1DKD (0-11)
• Chain 'H':
  Compound: 12-mer peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1DKD (Start-11)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dkdA (A:)
  egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
  aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
  katledlgqakrvvinkdtttiidgv
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dkdB (B:)
  egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
  aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
  katledlgqakrvvinkdtttiidgv
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dkdC (C:)
  egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
  aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
  katledlgqakrvvinkdtttiidgv
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dkdD (D:)
  egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
  aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
  katledlgqakrvvinkdtttiidgv
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.