SCOP: Structural Classification of Proteins and ASTRAL

Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)

PDB entry 1dkc

View 1dkc on RCSB PDB site
Description: solution structure of pafp-s, an antifungal peptide from the seeds of phytolacca americana
Class: antifungal protein
Keywords: three-strands beta sheet, antifungal protein
Deposited on 1999-12-07, released 2000-12-13
The last revision prior to the SCOP 1.75B freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: antifungal peptide
Species: Phytolacca americana [TaxId:3527]
Domains in SCOP 1.75B: d1dkca_

PDB Chain Sequences:

Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
```
>1dkcA (A:)
agciknggrcnasagppyccssycfqiagqsygvcknr
```