PDB entry 1dk8

View 1dk8 on RCSB PDB site
Description: crystal structure of the rgs-homologous domain of axin
Class: signaling protein
Keywords: alpha-helix, pi-helix, signaling protein
Deposited on 1999-12-06, released 2000-07-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.172
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Axin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1dk8a_
  • Heterogens: SO4, DTT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dk8A (A:)
    gsasptppylkwaeslhsllddqdgislfrtflkqegcadlldfwfactgfrklepcdsn
    eekrlklaraiyrkyildnngivsrqtkpatksfikgcimkqlidpamfdqaqteiqatm
    eentypsflksdiyleytrtgsespkv