PDB entry 1dk8

View 1dk8 on RCSB PDB site
Description: crystal structure of the rgs-homologous domain of axin
Class: signaling protein
Keywords: alpha-helix, pi-helix, signaling protein
Deposited on 1999-12-06, released 2000-07-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.172
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Axin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O15169 (0-146)
  Domains in SCOPe 2.08: d1dk8a_
• Heterogens: SO4, DTT, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dk8A (A:)
  gsasptppylkwaeslhsllddqdgislfrtflkqegcadlldfwfactgfrklepcdsn
  eekrlklaraiyrkyildnngivsrqtkpatksfikgcimkqlidpamfdqaqteiqatm
  eentypsflksdiyleytrtgsespkv