PDB entry 1dk7

View 1dk7 on RCSB PDB site
Description: crystal structure of an isolated apical domain of groEL
Class: chaperone
Keywords: molecular chaperone, protein folding, chaperone
Deposited on 1999-12-06, released 2000-01-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: groEL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dk7a_
  • Chain 'B':
    Compound: groEL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dk7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dk7A (A:)
    egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
    aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
    katledlgqakrvvinkdtttiidgv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dk7B (B:)
    egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
    aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
    katledlgqakrvvinkdtttiidgv