PDB entry 1dk5

View 1dk5 on RCSB PDB site
Description: crystal structure of annexin 24(ca32) from capsicum annuum
Class: metal binding protein
Keywords: plant annexin, capsicum annuum, bell pepper, calcium binding protein, metal binding protein
Deposited on 1999-12-06, released 2000-12-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.216
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: annexin 24(ca32)
    Species: Capsicum annuum [TaxId:4072]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q42657
      • expression tag (4-7)
    Domains in SCOPe 2.06: d1dk5a1, d1dk5a2
  • Chain 'B':
    Compound: annexin 24(ca32)
    Species: Capsicum annuum [TaxId:4072]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q42657 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.06: d1dk5b1, d1dk5b2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dk5A (A:)
    mahhhhhhmasltvpahvpsaaedceqlrsafkgwgtnekliisilahrtaaqrklirqt
    yaetfgedllkeldrelthdfeklvlvwtldpserdahlakeatkrwtksnfvlvelact
    rspkelvlareayharykksleedvayhttgdhrkllvplvssyryggeevdlrlakaes
    kilhekisdkaysddevirilatrskaqlnatlnhykdehgedilkqledgdefvallra
    tikglvypehyfvevlrdainrrgteedhltrviatraevdlkiiadeyqkrdsiplgra
    iakdtrgdyesmllallgqeed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dk5A (A:)
    hhhhmasltvpahvpsaaedceqlrsafkgwgtnekliisilahrtaaqrklirqtyaet
    fgedllkeldrelthdfeklvlvwtldpserdahlakeatkrwtksnfvlvelactrspk
    elvlareayharykksleedvayhttgdhrkllvplvssyryggeevdlrlakaeskilh
    ekisdkaysddevirilatrskaqlnatlnhykdehgedilkqledgdefvallratikg
    lvypehyfvevlrdainrrgteedhltrviatraevdlkiiadeyqkrdsiplgraiakd
    trgdyesmllallgqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dk5B (B:)
    mahhhhhhmasltvpahvpsaaedceqlrsafkgwgtnekliisilahrtaaqrklirqt
    yaetfgedllkeldrelthdfeklvlvwtldpserdahlakeatkrwtksnfvlvelact
    rspkelvlareayharykksleedvayhttgdhrkllvplvssyryggeevdlrlakaes
    kilhekisdkaysddevirilatrskaqlnatlnhykdehgedilkqledgdefvallra
    tikglvypehyfvevlrdainrrgteedhltrviatraevdlkiiadeyqkrdsiplgra
    iakdtrgdyesmllallgqeed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dk5B (B:)
    hmasltvpahvpsaaedceqlrsafkgwgtnekliisilahrtaaqrklirqtyaetfge
    dllkeldrelthdfeklvlvwtldpserdahlakeatkrwtksnfvlvelactrspkelv
    lareayharykksleedvayhttgdhrkllvplvssyryggeevdlrlakaeskilheki
    sdkaysddevirilatrskaqlnatlnhykdehgedilkqledgdefvallratikglvy
    pehyfvevlrdainrrgteedhltrviatraevdlkiiadeyqkrdsiplgraiakdtrg
    dyesmllallgqee