PDB entry 1dk5

View 1dk5 on RCSB PDB site
Description: crystal structure of annexin 24(ca32) from capsicum annuum
Deposited on 1999-12-06, released 2000-12-06
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-06, with a file datestamp of 2000-12-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.216
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dk5a_
  • Chain 'B':
    Domains in SCOP 1.55: d1dk5b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dk5A (A:)
    hhhhmasltvpahvpsaaedceqlrsafkgwgtnekliisilahrtaaqrklirqtyaet
    fgedllkeldrelthdfeklvlvwtldpserdahlakeatkrwtksnfvlvelactrspk
    elvlareayharykksleedvayhttgdhrkllvplvssyryggeevdlrlakaeskilh
    ekisdkaysddevirilatrskaqlnatlnhykdehgedilkqledgdefvallratikg
    lvypehyfvevlrdainrrgteedhltrviatraevdlkiiadeyqkrdsiplgraiakd
    trgdyesmllallgqe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dk5B (B:)
    hmasltvpahvpsaaedceqlrsafkgwgtnekliisilahrtaaqrklirqtyaetfge
    dllkeldrelthdfeklvlvwtldpserdahlakeatkrwtksnfvlvelactrspkelv
    lareayharykksleedvayhttgdhrkllvplvssyryggeevdlrlakaeskilheki
    sdkaysddevirilatrskaqlnatlnhykdehgedilkqledgdefvallratikglvy
    pehyfvevlrdainrrgteedhltrviatraevdlkiiadeyqkrdsiplgraiakdtrg
    dyesmllallgqee