PDB entry 1dk0

View 1dk0 on RCSB PDB site
Description: crystal structure of the hemophore hasa from serratia marcescens crystal form p2(1), ph8
Deposited on 1999-12-06, released 2000-12-27
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-27, with a file datestamp of 2000-12-27.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.175
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dk0a_
  • Chain 'B':
    Domains in SCOP 1.55: d1dk0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dk0A (A:)
    afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta
    nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls
    slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaata
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dk0B (B:)
    afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta
    nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls
    slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaata