PDB entry 1dk0

View 1dk0 on RCSB PDB site
Description: crystal structure of the hemophore hasa from serratia marcescens crystal form p2(1), ph8
Class: transport protein
Keywords: protein-heme complex; two heme insertions, transport protein
Deposited on 1999-12-06, released 2000-12-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.175
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heme-binding protein a
    Species: Serratia marcescens [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dk0a_
  • Chain 'B':
    Compound: heme-binding protein a
    Species: Serratia marcescens [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dk0b_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dk0A (A:)
    mafsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaisst
    anqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnl
    sslqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaatavgvqha
    dspellaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dk0A (A:)
    afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta
    nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls
    slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaata
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dk0B (B:)
    mafsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaisst
    anqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnl
    sslqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaatavgvqha
    dspellaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dk0B (B:)
    afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta
    nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls
    slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaata