PDB entry 1djy

View 1djy on RCSB PDB site
Description: phosphoinositide-specific phospholipase c-delta1 from rat complexed with inositol-2,4,5-trisphosphate
Deposited on 1996-08-24, released 1997-07-07
The last revision prior to the SCOP 1.55 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.21
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1djyA (A:)
    eietfykmltqraeidrafeeaagsaetlsverlvtflqhqqreeeagpalalslierye
    psetakaqrqmtkdgflmyllsadgnafslahrrvyqdmdqplshylvssshntylledq
    ltgpssteayiralckgcrcleldcwdgpnqepiiyhgytftskilfcdvlrairdyafk
    aspypvilslenhcsleqqrvmarhlrailgpilldqpldgvttslpspeqlkgkillkg
    kklggllpaggengseatdvsdeveaaemedeavrsqvqhkpkedklklvpelsdmiiyc
    ksvhfggfsspgtsgqafyemasfsesralrllqesgngfvrhnvsclsriypagwrtds
    snyspvemwnggcqivalnfqtpgpemdvylgcfqdnggcgyvlkpaflrdpnttfnsra
    ltqgpwwrperlrvriisgqqlpkvnknknsivdpkviveihgvgrdtgsrqtavitnng
    fnprwdmefefevtvpdlalvrfmvedydssskndfigqstipwnslkqgyrhvhllskn
    gdqhpsatlfvkisiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1djyA (A:)
    eietfykmltqraeidrafeeaagsaetlsverlvtflqhqqreeeagpalalslierye
    psetakaqrqmtkdgflmyllsadgnafslahrrvyqdmdqplshylvssshntylledq
    ltgpssteayiralckgcrcleldcwdgpnqepiiyhgytftskilfcdvlrairdyafk
    aspypvilslenhcsleqqrvmarhlrailgpilldqpldgvttslpspeqlkgkillkg
    kklklvpelsdmiiycksvhfggfsspgtsgqafyemasfsesralrllqesgngfvrhn
    vsclsriypagwrtdssnyspvemwnggcqivalnfqtpgpemdvylgcfqdnggcgyvl
    kpaflrdpnttfnsraltqgpwwrperlrvriisgqqlpkvnknknsivdpkviveihgv
    grdtgsrqtavitnngfnprwdmefefevtvpdlalvrfmvedydssskndfigqstipw
    nslkqgyrhvhllskngdqhpsatlfvkisiqd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1djyB (B:)
    nkmnfkelkdflkelniqvddgyarkifrecdhsqtdsledeeietfykmltqraeidra
    feeaagsaetlsverlvtflqhqqreeeagpalalslieryepsetakaqrqmtkdgflm
    yllsadgnafslahrrvyqdmdqplshylvssshntylledqltgpssteayiralckgc
    rcleldcwdgpnqepiiyhgytftskilfcdvlrairdyafkaspypvilslenhcsleq
    qrvmarhlrailgpilldqpldgvttslpspeqlkgkillkgkklggllpaggengseat
    dvsdeveaaemedeavrsqvqhkpkedklklvpelsdmiiycksvhfggfsspgtsgqaf
    yemasfsesralrllqesgngfvrhnvsclsriypagwrtdssnyspvemwnggcqival
    nfqtpgpemdvylgcfqdnggcgyvlkpaflrdpnttfnsraltqgpwwrperlrvriis
    gqqlpkvnknknsivdpkviveihgvgrdtgsrqtavitnngfnprwdmefefevtvpdl
    alvrfmvedydssskndfigqstipwnslkqgyrhvhllskngdqhpsatlfvkisiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1djyB (B:)
    nkmnfkelkdflkelniqvddgyarkifrecdhsqtdsledeeietfykmltqraeidra
    feeaagsaetlsverlvtflqhqqreeeagpalalslieryepsetakaqrqmtkdgflm
    yllsadgnafslahrrvyqdmdqplshylvssshntylledqltgpssteayiralckgc
    rcleldcwdgpnqepiiyhgytftskilfcdvlrairdyafkaspypvilslenhcsleq
    qrvmarhlrailgpilldqpldgvttslpspeqlkgkillkgkklggldklklvpelsdm
    iiycksvhfggfsspgtsgqafyemasfsesralrllqesgngfvrhnvsclsriypagw
    rtdssnyspvemwnggcqivalnfqtpgpemdvylgcfqdnggcgyvlkpaflrdpnttf
    nsraltqgpwwrperlrvriisgqqlpkvnknknsivdpkviveihgvgrdtgsrqtavi
    tnngfnprwdmefefevtvpdlalvrfmvedydssskndfigqstipwnslkqgyrhvhl
    lskngdqhpsatlfvkisiqd