PDB entry 1djx

View 1djx on RCSB PDB site
Description: phosphoinositide-specific phospholipase c-delta1 from rat complexed with inositol-1,4,5-trisphosphate
Class: lipid degradation
Keywords: phosphoric diester hydrolase, hydrolase, lipid degradation, transducer, calcium-binding, phospholipase c, phosphoinositide-specific
Deposited on 1996-08-24, released 1997-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.22
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoinositide-specific phospholipase c, isozyme delta1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CDNA FRAGMENT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1djxa1, d1djxa2, d1djxa3
  • Chain 'B':
    Compound: phosphoinositide-specific phospholipase c, isozyme delta1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CDNA FRAGMENT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1djxb1, d1djxb2, d1djxb3
  • Heterogens: CA, ACT, I3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1djxA (A:)
    gsmdqrqklqhwihsclrkadknkdnkmnfkelkdflkelniqvddgyarkifrecdhsq
    tdsledeeietfykmltqraeidrafeeaagsaetlsverlvtflqhqqreeeagpalal
    slieryepsetakaqrqmtkdgflmyllsadgnafslahrrvyqdmdqplshylvssshn
    tylledqltgpssteayiralckgcrcleldcwdgpnqepiiyhgytftskilfcdvlra
    irdyafkaspypvilslenhcsleqqrvmarhlrailgpilldqpldgvttslpspeqlk
    gkillkgkklggllpaggengseatdvsdeveaaemedeavrsqvqhkpkedklklvpel
    sdmiiycksvhfggfsspgtsgqafyemasfsesralrllqesgngfvrhnvsclsriyp
    agwrtdssnyspvemwnggcqivalnfqtpgpemdvylgcfqdnggcgyvlkpaflrdpn
    ttfnsraltqgpwwrperlrvriisgqqlpkvnknknsivdpkviveihgvgrdtgsrqt
    avitnngfnprwdmefefevtvpdlalvrfmvedydssskndfigqstipwnslkqgyrh
    vhllskngdqhpsatlfvkisiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1djxA (A:)
    eietfykmltqraeidrafeeaagsaetlsverlvtflqhqqreeeagpalalslierye
    psetakaqrqmtkdgflmyllsadgnafslahrrvyqdmdqplshylvssshntylledq
    ltgpssteayiralckgcrcleldcwdgpnqepiiyhgytftskilfcdvlrairdyafk
    aspypvilslenhcsleqqrvmarhlrailgpilldqpldgvttslpspeqlkgkillkg
    kklklvpelsdmiiycksvhfggfsspgtsgqafyemasfsesralrllqesgngfvrhn
    vsclsriypagwrtdssnyspvemwnggcqivalnfqtpgpemdvylgcfqdnggcgyvl
    kpaflrdpnttfnsraltqgpwwrperlrvriisgqqlpkvnknknsivdpkviveihgv
    grdtgsrqtavitnngfnprwdmefefevtvpdlalvrfmvedydssskndfigqstipw
    nslkqgyrhvhllskngdqhpsatlfvkisiqd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1djxB (B:)
    gsmdqrqklqhwihsclrkadknkdnkmnfkelkdflkelniqvddgyarkifrecdhsq
    tdsledeeietfykmltqraeidrafeeaagsaetlsverlvtflqhqqreeeagpalal
    slieryepsetakaqrqmtkdgflmyllsadgnafslahrrvyqdmdqplshylvssshn
    tylledqltgpssteayiralckgcrcleldcwdgpnqepiiyhgytftskilfcdvlra
    irdyafkaspypvilslenhcsleqqrvmarhlrailgpilldqpldgvttslpspeqlk
    gkillkgkklggllpaggengseatdvsdeveaaemedeavrsqvqhkpkedklklvpel
    sdmiiycksvhfggfsspgtsgqafyemasfsesralrllqesgngfvrhnvsclsriyp
    agwrtdssnyspvemwnggcqivalnfqtpgpemdvylgcfqdnggcgyvlkpaflrdpn
    ttfnsraltqgpwwrperlrvriisgqqlpkvnknknsivdpkviveihgvgrdtgsrqt
    avitnngfnprwdmefefevtvpdlalvrfmvedydssskndfigqstipwnslkqgyrh
    vhllskngdqhpsatlfvkisiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1djxB (B:)
    nkmnfkelkdflkelniqvddgyarkifrecdhsqtdsledeeietfykmltqraeidra
    feeaagsaetlsverlvtflqhqqreeeagpalalslieryepsetakaqrqmtkdgflm
    yllsadgnafslahrrvyqdmdqplshylvssshntylledqltgpssteayiralckgc
    rcleldcwdgpnqepiiyhgytftskilfcdvlrairdyafkaspypvilslenhcsleq
    qrvmarhlrailgpilldqpldgvttslpspeqlkgkillkgkklggldklklvpelsdm
    iiycksvhfggfsspgtsgqafyemasfsesralrllqesgngfvrhnvsclsriypagw
    rtdssnyspvemwnggcqivalnfqtpgpemdvylgcfqdnggcgyvlkpaflrdpnttf
    nsraltqgpwwrperlrvriisgqqlpkvnknknsivdpkviveihgvgrdtgsrqtavi
    tnngfnprwdmefefevtvpdlalvrfmvedydssskndfigqstipwnslkqgyrhvhl
    lskngdqhpsatlfvkisiqd