PDB entry 1dju

View 1dju on RCSB PDB site
Description: crystal structure of aromatic aminotransferase from pyrococcus horikoshii ot3
Class: transferase
Keywords: alpha/beta/alpha, transferase
Deposited on 1999-12-06, released 2001-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aromatic aminotransferase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59096 (0-387)
      • conflict (375)
    Domains in SCOPe 2.07: d1djua_
  • Chain 'B':
    Compound: aromatic aminotransferase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59096 (0-387)
      • conflict (375)
    Domains in SCOPe 2.07: d1djub_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1djuA (A:)
    alsdrlelvsaseirklfdiaagmkdvislgigepdfdtpqhikeyakealdkglthygp
    nigllelreaiaeklkkqngieadpkteimvllganqaflmglsaflkdgeevliptpaf
    vsyapavilaggkpvevptyeedefrlnvdelkkyvtdktraliinspcnptgavltkkd
    leeiadfvvehdlivisdevyehfiyddarhysiasldgmfertitvngfsktfamtgwr
    lgfvaapswiiermvkfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrklv
    wkrlnemglptvkpkgafyifprirdtgltskkfselmlkearvavvpgsafgkagegyv
    risyatayekleeamermervlkerklv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1djuA (A:)
    alsdrlelvsakdvislgigepdfdtpqhikeyakealdkglthygpnigllelreaiae
    klkkqngieadpkteimvllganqaflmglsaflkdgeevliptpafvsyapavilaggk
    pvevptyeedefrlnvdelkkyvtdktraliinspcnptgavltkkdleeiadfvvehdl
    ivisdevyehfiyddarhysiasldgmfertitvngfsktfamtgwrlgfvaapswiier
    mvkfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrklvwkrlnemglptvk
    pkgafyifprirdtgltskkfselmlkearvavvpgsafgkagegyvrisyatayeklee
    amermervlkerklv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1djuB (B:)
    alsdrlelvsaseirklfdiaagmkdvislgigepdfdtpqhikeyakealdkglthygp
    nigllelreaiaeklkkqngieadpkteimvllganqaflmglsaflkdgeevliptpaf
    vsyapavilaggkpvevptyeedefrlnvdelkkyvtdktraliinspcnptgavltkkd
    leeiadfvvehdlivisdevyehfiyddarhysiasldgmfertitvngfsktfamtgwr
    lgfvaapswiiermvkfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrklv
    wkrlnemglptvkpkgafyifprirdtgltskkfselmlkearvavvpgsafgkagegyv
    risyatayekleeamermervlkerklv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1djuB (B:)
    alsdrlelvsdvislgigepdfdtpqhikeyakealdkglthygpnigllelreaiaekl
    kkqngieadpkteimvllganqaflmglsaflkdgeevliptpafvsyapavilaggkpv
    evptyeedefrlnvdelkkyvtdktraliinspcnptgavltkkdleeiadfvvehdliv
    isdevyehfiyddarhysiasldgmfertitvngfsktfamtgwrlgfvaapswiiermv
    kfqmynatcpvtfiqyaaakalkderswkaveemrkeydrrrklvwkrlnemglptvkpk
    gafyifprirdtgltskkfselmlkearvavvpgsafgkagegyvrisyatayekleeam
    ermervlkerklv