PDB entry 1djt

View 1djt on RCSB PDB site
Description: atomic resolution structure of scorpion alpha-like toxin bmk m1 in a new crystal form
Class: toxin
Keywords: scorpion, alpha-like neurotoxin, non-proline cis peptide bond, atomic resolution
Deposited on 1999-12-05, released 2000-12-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.109
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: alpha-like neurotoxin bmk m1
  Species: Mesobuthus martensii [TaxId:34649]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45697 (0-63)
  Domains in SCOPe 2.08: d1djta_
• Chain 'B':
  Compound: alpha-like neurotoxin bmk m1
  Species: Mesobuthus martensii [TaxId:34649]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45697 (0-63)
  Domains in SCOPe 2.08: d1djtb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1djtA (A:)
  vrdayiakphncvyecarneycndlctkngaksgycqwvgkygngcwcielpdnvpirvp
  gkch
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1djtB (B:)
  vrdayiakphncvyecarneycndlctkngaksgycqwvgkygngcwcielpdnvpirvp
  gkch