PDB entry 1djr

View 1djr on RCSB PDB site
Description: heat-labile enterotoxin b-pentamer complexed with m-carboxyphenyl-alpha-d-galactose
Class: toxin
Keywords: ab5 toxins, cell recognition, six-stranded antiparallel beta-sheet, toxin
Deposited on 1999-12-03, released 2000-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.133
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: heat-labile enterotoxin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1djrd_
  • Chain 'E':
    Compound: heat-labile enterotoxin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1djre_
  • Chain 'F':
    Compound: heat-labile enterotoxin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1djrf_
  • Chain 'G':
    Compound: heat-labile enterotoxin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1djrg_
  • Chain 'H':
    Compound: heat-labile enterotoxin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1djrh_
  • Heterogens: GLA, BEZ, GOL, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1djrD (D:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1djrE (E:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1djrF (F:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1djrG (G:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1djrH (H:)
    apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn