PDB entry 1djp

View 1djp on RCSB PDB site
Description: crystal structure of pseudomonas 7a glutaminase-asparaginase with the inhibitor don covalently bound in the active site
Class: hydrolase
Keywords: PGA, Glutaminase, Asparaginase, DON, 6-diazo-5-oxo-L-norvaline, Glutaminase-Asparaginase, suicide inhibitor, covalently bound inhibitor, HYDROLASE
Deposited on 1999-12-03, released 2000-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaminase-asparaginase
    Species: Pseudomonas sp. [TaxId:65406]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10182
      • see remark 999 (103)
      • see remark 999 (105-107)
      • see remark 999 (255-256)
      • see remark 999 (261)
      • see remark 999 (265)
      • see remark 999 (309-311)
      • see remark 999 (314)
    Domains in SCOPe 2.07: d1djpa_
  • Chain 'B':
    Compound: glutaminase-asparaginase
    Species: Pseudomonas sp. [TaxId:65406]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10182 (0-329)
      • see remark 999 (103)
      • see remark 999 (105-107)
      • see remark 999 (255-256)
      • see remark 999 (261)
      • see remark 999 (265)
      • see remark 999 (309-311)
      • see remark 999 (314)
    Domains in SCOPe 2.07: d1djpb_
  • Heterogens: DO2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1djpA (A:)
    klanvvilatggtiagagasaansatyqaakvgvdkliagvpeladlanvrgeqvmqias
    esitnddllklgkrvaeladsndvdgivithgtdtleetayflnlvqktdkpivvvgsmr
    pgtamsadgmlnlynavavasnkdsrgkgvlvtmndeiqsgrdvsksinikteafksawg
    plgmvvegksywfrlpakrhtvnsefdikqisslpqvdiaysygnvtdtaykalaqngak
    alihagtgngsvssrvvpalqqlrkngtqiirsshvnqggfvlrnaeqpddkndwvvahd
    lnpekarilamvamtktqdskelqrifwey
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1djpB (B:)
    klanvvilatggtiagagasaansatyqaakvgvdkliagvpeladlanvrgeqvmqias
    esitnddllklgkrvaeladsndvdgivithgtdtleetayflnlvqktdkpivvvgsmr
    pgtamsadgmlnlynavavasnkdsrgkgvlvtmndeiqsgrdvsksinikteafksawg
    plgmvvegksywfrlpakrhtvnsefdikqisslpqvdiaysygnvtdtaykalaqngak
    alihagtgngsvssrvvpalqqlrkngtqiirsshvnqggfvlrnaeqpddkndwvvahd
    lnpekarilamvamtktqdskelqrifwey