PDB entry 1djo

View 1djo on RCSB PDB site
Description: Crystal structure of Pseudomonas 7A Glutaminase-asparaginase with the inhibitor donv covalently bound in the active site
Class: hydrolase/hydrolase inhibitor
Keywords: PGA, Glutaminase, Asparaginase, DONV, 5-diazo-4-oxo-L-norvaline, Glutaminase-Asparaginase, suicide inhibitor, covalently bound inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1999-12-03, released 2000-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaminase-asparaginase
    Species: Pseudomonas sp. [TaxId:65406]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10182
      • see remark 999 (103)
      • see remark 999 (105-107)
      • see remark 999 (255-256)
      • see remark 999 (261)
      • see remark 999 (265)
      • see remark 999 (309-311)
      • see remark 999 (314)
    Domains in SCOPe 2.07: d1djoa_
  • Chain 'B':
    Compound: glutaminase-asparaginase
    Species: Pseudomonas sp. [TaxId:65406]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10182 (0-329)
      • see remark 999 (103)
      • see remark 999 (105-107)
      • see remark 999 (255-256)
      • see remark 999 (261)
      • see remark 999 (265)
      • see remark 999 (309-311)
      • see remark 999 (314)
    Domains in SCOPe 2.07: d1djob_
  • Heterogens: CAB

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1djoA (A:)
    klanvvilatggtiagagasaansatyqaakvgvdkliagvpeladlanvrgeqvmqias
    esitnddllklgkrvaeladsndvdgivithgtdtleetayflnlvqktdkpivvvgsmr
    pgtamsadgmlnlynavavasnkdsrgkgvlvtmndeiqsgrdvsksinikteafksawg
    plgmvvegksywfrlpakrhtvnsefdikqisslpqvdiaysygnvtdtaykalaqngak
    alihagtgngsvssrvvpalqqlrkngtqiirsshvnqggfvlrnaeqpddkndwvvahd
    lnpekarilamvamtktqdskelqrifwey
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1djoB (B:)
    klanvvilatggtiagagasaansatyqaakvgvdkliagvpeladlanvrgeqvmqias
    esitnddllklgkrvaeladsndvdgivithgtdtleetayflnlvqktdkpivvvgsmr
    pgtamsadgmlnlynavavasnkdsrgkgvlvtmndeiqsgrdvsksinikteafksawg
    plgmvvegksywfrlpakrhtvnsefdikqisslpqvdiaysygnvtdtaykalaqngak
    alihagtgngsvssrvvpalqqlrkngtqiirsshvnqggfvlrnaeqpddkndwvvahd
    lnpekarilamvamtktqdskelqrifwey