PDB entry 1djn

View 1djn on RCSB PDB site
Description: structural and biochemical characterization of recombinant wild type trimethylamine dehydrogenase from methylophilus methylotrophus (sp. w3a1)
Class: oxidoreductase
Keywords: iron-sulfur flavoprotein, electron transfer, oxidoreductase
Deposited on 1999-12-03, released 1999-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trimethylamine dehydrogenase
    Species: METHYLOPHILUS METHYLOTROPHUS [TaxId:2327]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1djna1, d1djna2, d1djna3
  • Chain 'B':
    Compound: trimethylamine dehydrogenase
    Species: METHYLOPHILUS METHYLOTROPHUS [TaxId:2327]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1djnb1, d1djnb2, d1djnb3
  • Heterogens: SF4, FMN, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1djnA (A:)
    ardpkhdilfepiqigpktlrnrfyqvphcigagsdkpgfqsahrsvkaeggwaalntey
    csinpesddthrlsariwdegdvrnlkamtdevhkygalagvelwyggahapnmesratp
    rgpsqyasefetlsyckemdlsdiaqvqqfyvdaakrsrdagfdivyvygahsylplqfl
    npyynkrtdkyggslenrarfwletlekvkhavgsdcaiatrfgvdtvygpgqieaevdg
    qkfvemadslvdmwditigdiaewgedagpsrfyqqghtipwvklvkqvskkpvlgvgry
    tdpekmieivtkgyadiigcarpsiadpflpqkveqgryddirvcigcnvcisrweiggp
    pmictqnatageeyrrgwhpekfrqtknkdsvlivgagpsgseaarvlmesgytvhltdt
    aekigghlnqvaalpglgewsyhrdyretqitkllkknkesqlalgqkpmtaddvlqyga
    dkviiatgarwntdgtnclthdpipgadaslpdqltpeqvmdgkkkigkrvvilnadtyf
    mapslaeklataghevtivsgvhlanymhftleypnmmrrlhelhveelgdhfcsriepg
    rmeiyniwgdgskrtyrgpgvsprdantshrwiefdslvlvtgrhsectlwnelkarese
    waendikgiyligdaeaprliadatftghrvareieeanpqiaipykretiawgtphmpg
    gnfkieykv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1djnB (B:)
    ardpkhdilfepiqigpktlrnrfyqvphcigagsdkpgfqsahrsvkaeggwaalntey
    csinpesddthrlsariwdegdvrnlkamtdevhkygalagvelwyggahapnmesratp
    rgpsqyasefetlsyckemdlsdiaqvqqfyvdaakrsrdagfdivyvygahsylplqfl
    npyynkrtdkyggslenrarfwletlekvkhavgsdcaiatrfgvdtvygpgqieaevdg
    qkfvemadslvdmwditigdiaewgedagpsrfyqqghtipwvklvkqvskkpvlgvgry
    tdpekmieivtkgyadiigcarpsiadpflpqkveqgryddirvcigcnvcisrweiggp
    pmictqnatageeyrrgwhpekfrqtknkdsvlivgagpsgseaarvlmesgytvhltdt
    aekigghlnqvaalpglgewsyhrdyretqitkllkknkesqlalgqkpmtaddvlqyga
    dkviiatgarwntdgtnclthdpipgadaslpdqltpeqvmdgkkkigkrvvilnadtyf
    mapslaeklataghevtivsgvhlanymhftleypnmmrrlhelhveelgdhfcsriepg
    rmeiyniwgdgskrtyrgpgvsprdantshrwiefdslvlvtgrhsectlwnelkarese
    waendikgiyligdaeaprliadatftghrvareieeanpqiaipykretiawgtphmpg
    gnfkieykv