PDB entry 1djm

View 1djm on RCSB PDB site
Description: solution structure of bef3-activated chey from escherichia coli
Class: signaling protein
Keywords: befx, chey, response regulator, chemotaxis, two-component, signaling protein
Deposited on 1999-12-03, released 2000-04-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chemotaxis protein y
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06143 (0-128)
  Domains in SCOPe 2.05: d1djma_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1djmA (A:)
  madkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnm
  pnmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekl
  nkifeklgm