PDB entry 1djm

View 1djm on RCSB PDB site
Description: solution structure of bef3-activated chey from escherichia coli
Class: signaling protein
Keywords: befx, chey, response regulator, chemotaxis, two-component, signaling protein
Deposited on 1999-12-03, released 2000-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chemotaxis protein y
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1djma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1djmA (A:)
    madkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnm
    pnmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekl
    nkifeklgm