PDB entry 1dje

View 1dje on RCSB PDB site
Description: crystal structure of the plp-bound form of 8-amino-7-oxonanoate synthase
Class: transferase
Keywords: biotin biosynthesis, 8-amino-7-oxonanoate synthase, 8-amino-7-ketopelargonate synthase, transferase
Deposited on 1999-12-02, released 2000-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 8-amino-7-oxonanoate synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1djea_
  • Heterogens: SO4, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1djeA (A:)
    mswqekinaaldargaadalrrrypvaqgagrwlvaddrqylnfssndylglshhpqiir
    awqqgaeqfgigsggsghvsgysvvhqaleeelaewlgysrallfisgfaanqaviaamm
    akedriaadrlshaslleaaslspsqlrrfahndvthlarllaspcpgqqmvvtegvfsm
    dgdsaplaeiqqvtqqhngwlmvddahgtgvigeqgrgscwlqkvkpellvvtfgkgfgv
    sgaavlcsstvadyllqfarhliystsmppaqaqalraslavirsdegdarreklaalit
    rfragvqdlpftladscsaiqplivgdnsralqlaeklrqqgcwvtgirpptvpagiarl
    rltltaahemqdidrllevlhgng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1djeA (A:)
    swqekinaaldargaadalrrrypvaqgagrwlvaddrqylnfssndylglshhpqiira
    wqqgaeqfgigsggsghvsgysvvhqaleeelaewlgysrallfisgfaanqaviaamma
    kedriaadrlshaslleaaslspsqlrrfahndvthlarllaspcpgqqmvvtegvfsmd
    gdsaplaeiqqvtqqhngwlmvddahgtgvigeqgrgscwlqkvkpellvvtfgkgfgvs
    gaavlcsstvadyllqfarhliystsmppaqaqalraslavirsdegdarreklaalitr
    fragvqdlpftladscsaiqplivgdnsralqlaeklrqqgcwvtgirpptvpagiarlr
    ltltaahemqdidrllevlhgng