PDB entry 1djc

View 1djc on RCSB PDB site
Description: structure of beta-lactamase precursor, s70a mutant, at 120k
Class: hydrolase
Keywords: hydrolase, antibiotic resistance, signal, plasmid, transposable element
Deposited on 1996-08-13, released 1997-03-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.171
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: BLAZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00807 (0-256)
      • engineered (38)
    Domains in SCOPe 2.08: d1djca_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1djcA (A:)
kelndlekkynahigvyaldtksgkevkfnsdkrfayaatskainsailleqvpynklnk
kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
elgdkvtnpvryeielnyyspkskkdtstpaafgktlnkliangklskenkkflldlmln
nksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksdk
pndklisetaksvmkef