PDB entry 1dja

View 1dja on RCSB PDB site
Description: structure of beta-lactamase precursor, k73h mutant, at 298k
Class: hydrolase
Keywords: hydrolase, antibiotic resistance
Deposited on 1996-08-13, released 1997-03-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.168
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: BLAZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00807 (1-257)
      • engineered (42)
    Domains in SCOPe 2.08: d1djaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1djaA (A:)
mkelndlekkynahigvyaldtksgkevkfnsdkrfayastshainsailleqvpynkln
kkvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrl
kelgdkvtnpvryeielnyyspkskkdtstpaafgktlnkliangklskenkkflldlml
nnksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksd
kpndklisetaksvmkef